PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang0058ss00460.1
Common NameLR48_Vigan05g201000
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family MYB_related
Protein Properties Length: 139aa    MW: 15414.2 Da    PI: 6.1294
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang0058ss00460.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding32.32.4e-101443130
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHH CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIart 30
                       rg W++eEde+l+++++ +G g+W+++++ 
  Vang0058ss00460.1 14 RGLWSPEEDEKLINYITTYGHGCWSSVPKL 43
                       789************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.4E-14643IPR009057Homeodomain-like
SuperFamilySSF466898.61E-9944IPR009057Homeodomain-like
PROSITE profilePS512949.036962IPR017930Myb domain
PfamPF002498.2E-81444IPR001005SANT/Myb domain
CDDcd001671.30E-61742No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 139 aa     Download sequence    Send to blast
MGHHSCCNKQ KVKRGLWSPE EDEKLINYIT TYGHGCWSSV PKLAESTWSS LGCVPIHLNP  60
NQQSQTITTK SDTTPHLILE KFINPSTWQN QAVEPTIDLV PKVCESIEDY VCSIPFSSSA  120
NSQHQHEDAV ACYTPEGK*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150401e-152AP015040.1 Vigna angularis var. angularis DNA, chromosome 7, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014500689.12e-54PREDICTED: transcription factor MYB26-like
TrEMBLA0A0L9UNC82e-57A0A0L9UNC8_PHAAN; Uncharacterized protein
STRINGGLYMA13G42431.11e-37(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF1750046
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13890.22e-25myb domain protein 26
Publications ? help Back to Top
  1. Yang K, et al.
    Genome sequencing of adzuki bean (Vigna angularis) provides insight into high starch and low fat accumulation and domestication.
    Proc. Natl. Acad. Sci. U.S.A., 2015. 112(43): p. 13213-8
    [PMID:26460024]